PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676752376
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family ZF-HD
Protein Properties Length: 294aa    MW: 32690.1 Da    PI: 6.458
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676752376genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.13.9e-3277130357
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrev 57 
                  ++r++eClkN+A+++GghavDGCgEfmp+ g egt++alkCaACgCHRnFHR+e 
    676752376  77 RFRFRECLKNQAVNIGGHAVDGCGEFMPA-GIEGTIDALKCAACGCHRNFHRKEL 130
                  789*************************9.999********************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.5E-2878129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015666.7E-2979129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.41580129IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257744.0E-2482130IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.604.7E-30186258IPR009057Homeodomain-like
SuperFamilySSF466893.05E-18188258IPR009057Homeodomain-like
TIGRFAMsTIGR015659.9E-26197253IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0010431Biological Processseed maturation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MEFEEDNNNN NNNEEEDEMN LHEEEEEDDA VYDSPPLAPP SSRVLKSSTE SPDTTGTTST  60
GGGGFMVVHG GSSGGSRFRF RECLKNQAVN IGGHAVDGCG EFMPAGIEGT IDALKCAACG  120
CHRNFHRKEL PYFSHHAPPQ HQPPPPPGFY RLPAPVSYRP PPSQAPPLQL ALPPPPQRER  180
SEDRMETSSA EAGGGIRKRF RTKFTPEQKE RMLGLAERIG WRIQRQDDEV IQRFCQETGV  240
PRQVLKVWLH NNKHTLGKSS SPPLHHHHHQ NPTLAPPPPP PPQSSSFHHE QDQS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A2e-341962551675ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00588DAPTransfer from AT5G65410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534950.0AK353495.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-46-M17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009130511.11e-147PREDICTED: zinc-finger homeodomain protein 1-like
RefseqXP_013722360.11e-147PREDICTED: zinc-finger homeodomain protein 1-like isoform X2
SwissprotQ9FKP81e-131ZHD1_ARATH; Zinc-finger homeodomain protein 1
TrEMBLA0A078HIY51e-147A0A078HIY5_BRANA; BnaAnng04880D protein
TrEMBLM4ESS91e-147M4ESS9_BRARP; Uncharacterized protein
STRINGBra031859.1-P1e-146(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM132371728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65410.11e-103homeobox protein 25